PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT03529
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family CO-like
Protein Properties Length: 482aa    MW: 52818.1 Da    PI: 4.5824
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT03529genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.32.3e-06637536
  zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg 36
               C+ ++e++ +++C+++   lC +C  + H+ 
  EMT03529  6 LCDFCGEQRPTIYCRSDAASLCLSCDHNVHSA 37
              7***************************9965 PP

2zf-B_box22.62.2e-074980536
  zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg 36
               C+++ ++++   C + ++ lC++C  ++H  
  EMT03529 49 LCDRCASQPAAVRCLEENTSLCQNCDWNGHAA 80
              7***************************9954 PP

3CCT51.44e-18335373139
       CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGr 39 
               R  al+RY eK+k+RkF+KkirY+sRKa+A+ R+RvKGr
  EMT03529 335 RGSALSRYMEKKKRRKFDKKIRYASRKARADVRKRVKGR 373
               6789**********************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.3E-10249IPR000315B-box-type zinc finger
PROSITE profilePS501199.456249IPR000315B-box-type zinc finger
CDDcd000216.95E-5637No hitNo description
PROSITE profilePS501198.8454592IPR000315B-box-type zinc finger
CDDcd000212.06E-44980No hitNo description
SMARTSM003360.255092IPR000315B-box-type zinc finger
PfamPF062034.9E-13335373IPR010402CCT domain
PROSITE profilePS5101713.275335377IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
MIMDALCDFC GEQRPTIYCR SDAASLCLSC DHNVHSANTL SQRHMRTLLC DRCASQPAAV  60
RCLEENTSLC QNCDWNGHAA TSLAAGHLRQ TINCYSGCPS SEELARIWSF DFDAPSAATE  120
PNCEEGISMM SINDSGVSNH CGVQQDCSLL DIANTSLMSD PPTVEKLKSE DEMNLRPLPT  180
HQPAQSVSMA PKVPSVTDDD MFNDGRVYEN FCVDDNDLTF ENYEELFGTP HVQTEQLFDD  240
AGIDSFFEMK EMPAADCDQQ LTPVQPECSN AVSADSGLCV PARQAISTIS LSFSGLTGES  300
NAGDHQDCGV SPLLLMGEQP WLPPGSEVSS AGGSRGSALS RYMEKKKRRK FDKKIRYASR  360
KARADVRKRV KGRDKSSQLT THRMRGHIPA AASVCDAGYE AEVCMYVSMW ALGLCSLICA  420
RIAILQSSIQ AAMVSWNDGE SSDDSLAEFD SHPPLTFQDF DFEGIVDFEC DHKKNAKKFG  480
AF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1344348KKKRR
2344349KKKRRK
3345349KKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2526660.0AK252666.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf169b05, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570474.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9
TrEMBLN1QRZ40.0N1QRZ4_AEGTA; Uncharacterized protein
STRINGMLOC_50966.40.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20793788
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48250.12e-81B-box type zinc finger protein with CCT domain